PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_31770V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 228aa    MW: 25630.8 Da    PI: 6.6728
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_31770V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-151764148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd +l+  +k  G g+W+t +++ g++R++k+c++rw +yl
  Pp3c2_31770V3.1.p 17 KGPWTEEEDAILIAFIKADGEGNWRTLPKRSGLKRCRKSCRLRWMNYL 64
                       79********************************************97 PP

2Myb_DNA-binding49.11.3e-1570113146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg++++eEdel+++++ +l ++ W++Ia +++ gR ++++k++w++
  Pp3c2_31770V3.1.p  70 RGNFSPEEDELIIKLHSLLENR-WSLIAGRIP-GRKDNEIKNYWNS 113
                        89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.4061264IPR017930Myb domain
SuperFamilySSF466892.45E-2815111IPR009057Homeodomain-like
SMARTSM007178.8E-121666IPR001005SANT/Myb domain
PfamPF002494.5E-131764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-221871IPR009057Homeodomain-like
CDDcd001675.22E-101964No hitNo description
PROSITE profilePS5129421.61865119IPR017930Myb domain
SMARTSM007177.8E-1469117IPR001005SANT/Myb domain
PfamPF002494.3E-1470113IPR001005SANT/Myb domain
CDDcd001671.17E-1072115No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2472119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MGRAPCGRVQ SEEGFYKGPW TEEEDAILIA FIKADGEGNW RTLPKRSGLK RCRKSCRLRW  60
MNYLRPDLER GNFSPEEDEL IIKLHSLLEN RWSLIAGRIP GRKDNEIKNY WNSRLRRRLG  120
RMESDPICRE VVATPLSIAS LESSIKVEVE SSCSHLDTGE SSSLDSIATN LSSHFTTPEP  180
SDQEAPLSSD AHDISNFPQF TLFPSVIRQG EAITSTPSSH ETVVGRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25151195108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001783614.13e-80predicted protein
SwissprotP200262e-56MYB1_HORVU; Myb-related protein Hv1
TrEMBLA9TYB43e-80A9TYB4_PHYPA; Predicted protein
STRINGPP1S371_6V6.11e-166(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.15e-57myb domain protein 4